PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G036900.2.p
Common NameSb04g003175, SORBIDRAFT_04g003175
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 481aa    MW: 51405 Da    PI: 8.9189
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G036900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.33.4e-41180256278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           CqvegC++dls+akeyhr+hkvCe hska++v+v+gle+rfCqqCsrfh lsefD++k+sCrrrL++hn+rrrk+q+
  Sobic.004G036900.2.p 180 CQVEGCKVDLSSAKEYHRKHKVCEPHSKASKVVVAGLERRFCQQCSRFHGLSEFDQKKKSCRRRLNDHNARRRKPQP 256
                           **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-32173241IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.009177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-39179259IPR004333Transcription factor, SBP-box
PfamPF031102.4E-31180253IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MGSFGMDWNQ KASVLWDWEN LPPIGANMSD NPRMTAAPQG EAKFAGLEAT RHESVHSSCG  60
TFSSSSEMGY GSSKSSVSAS TDSSPKAKGN SMELNFAPAK APDKNTDSGK VDDARTSPSS  120
VIAISSGEPV LSLKLGKRTY FEDVCGGQSV KSLPSDTSAV TPLASAKKAK SAPNTQKSYC  180
QVEGCKVDLS SAKEYHRKHK VCEPHSKASK VVVAGLERRF CQQCSRFHGL SEFDQKKKSC  240
RRRLNDHNAR RRKPQPEAFS FGSSRLSTMF YDTRQQTNLP FGQGPYGQMR SCANSSWDNP  300
VGGFKFAETK APWLRAAGVD GLHLSSQQVW NNFMPHGVHQ DFDGFTAFKE TSAKVLDQGA  360
EASAVVSNPD GAPDLQRALS LLSNSSAGAG TNQQPTAQLH HHHAGLSTLA ASSSSVMQAS  420
SPGLWQDSSG TALGHHAHAR FQALDAPGSG AAIATAQELL QLPRSPSLYD SSSSHYDLMR  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281802531184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235252KKKSCRRRLNDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0395210.0BT039521.1 Zea mays full-length cDNA clone ZM_BFc0017D10 mRNA, complete cds.
GenBankBT0399450.0BT039945.1 Zea mays full-length cDNA clone ZM_BFc0054D09 mRNA, complete cds.
GenBankBT0538640.0BT053864.1 Zea mays full-length cDNA clone ZM_BFb0339F10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451519.10.0hypothetical protein SORBIDRAFT_04g003175
SwissprotA2X0Q61e-170SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z81e-170SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLC5XUJ30.0C5XUJ3_SORBI; Putative uncharacterized protein Sb04g003175
STRINGSb04g003175.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-41squamosa promoter binding protein-like 2